- CHMP4B Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP2-49018
- 0.1 ml (also 25ul)
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Human
- CHMP4B
- IgG
- Rabbit
- This antibody was developed against a recombinant protein corresponding to amino acids: EQEELDKNLL EISGPETVPL PNVPSIALPS KPAKKKEEED DDMKELENWA GSV
- charged multivesicular body protein 4B
- C20orf178, CHMP4A, CTPP3, CTRCT31, SNF7, SNF7-2, Shax1, VPS32B, Vps32-2, dJ553F4.4
- Polyclonal
- Immunogen affinity purified
- Novus Biologicals, a Bio-Techne Brand
- Primary Antibodies
- Autophagy, Cell Biology, Cell Cycle and Replication, Immunology, Signal Transduction
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
EQEELDKNLLEISGPETVPLPNVPSIALPSKPAKKKEEEDDDMKELENWAGSV
Specifications/Features
Available conjugates: Unconjugated